PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g16230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 262aa    MW: 29428 Da    PI: 7.1454
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g16230.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.7e-1767114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT +Ed+ l+++++ +G g+W+t a   g++Rt+k+c++rw++yl
   Vang11g16230.1  67 RGPWTVDEDLTLINYIATHGEGRWNTLALSAGLKRTGKSCRLRWLNYL 114
                      89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.11762118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2064117IPR009057Homeodomain-like
SMARTSM007176.2E-1466116IPR001005SANT/Myb domain
PfamPF002497.9E-1667114IPR001005SANT/Myb domain
SuperFamilySSF466891.58E-2168142IPR009057Homeodomain-like
CDDcd001671.41E-1169114No hitNo description
Gene3DG3DSA:1.10.10.605.5E-6118141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
HNSTPFSLPF SISISIHRQT QTQPNKQTNQ PLFFFPFDTT LVASPMDEKP RRTCNTLLTD  60
DEIDLRRGPW TVDEDLTLIN YIATHGEGRW NTLALSAGLK RTGKSCRLRW LNYLRPDVRR  120
GNITLEEQLL ILELHSRWGN RLVERIQAAA TATASVATNN AYNSENNIKN NQIEVHNLKD  180
KMGLIEPSLM NNDFVGSYVM QSHTPENSST ALSSSDSFGT QVSTKSDLTD YYSVPQPTRV  240
FASRIGFSIP RSVEPAEWGL V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-156416424122MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-162AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158818.11e-104hypothetical protein PHAVU_002G184600g
TrEMBLV7CKV21e-104V7CKV2_PHAVU; Uncharacterized protein
STRINGGLYMA07G36430.25e-70(Glycine max)
STRINGGLYMA17G04171.14e-70(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.17e-40myb domain protein 108